UniProt data
UniProt name: SC61G_HUMAN (P60059)
Gene name: SEC61G
Organism: Homo sapiens (Human).
Function: Necessary for protein translocation in the endoplasmic reticulum. {ECO:0000250}.
Subcellular location: Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}.
Transmembrane domains:
- 33-61, 29 AA, Helical. {ECO:0000255}.
Sequence: 68 AA
CATM prediction
The sequence of SC61G_HUMAN returned 3 potential models
The positions at the dimer's interface are highlighted in yellow. The position at the crossing point is highlighted in orange.
| # | Sequence and interface | d | θ | Z' | ω' | Score |
|---|---|---|---|---|---|---|
| 30 40 50 60 | + | + | + | |
(Å) | (°) | (Å) | (°) | ||
| Model 1 | RKEFQKIAMATAIGFAIMGFIGFFVKLIHIAINNI | 7.1 | +52.0° | 1.8 | 0.9 | -20.8 |
| Model 2 | RKEFQKIAMATAIGFAIMGFIGFFVKLIHIAINNI | 7.4 | -54.0° | 3.6 | 48.9 | -20.3 |
| Model 3 | RKEFQKIAMATAIGFAIMGFIGFFVKLIHIAINNI | 7.4 | -50.7° | 3.3 | 47.8 | -1.3 |
| Prolines* | RKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNI |
* Note: this sequence contains Pro residues. CATM substituted them with Ala during the modeling. The positions are marked.
Click on the model number to visualize its details below.
MODEL 1 DETAILS
Precited structure:
Click on the image to enlarge
Download model 1 structure: PDB, PyMOL session
List of hydrogen bonds:
| Donor | Acceptor | Distance |
|---|---|---|
| B, 48, GLY, HA1 | A, 44, PHE, O | 3.42Å |
| B, 48, GLY, HA2 | A, 47, MET, O | 3.43Å |
| A, 48, GLY, HA1 | B, 44, PHE, O | 3.42Å |
| A, 48, GLY, HA2 | B, 47, MET, O | 3.43Å |
