UniProt data
UniProt name: CX7A1_HUMAN (P24310)
Gene name: COX7A1; Synonyms=COX7AH
Organism: Homo sapiens (Human).
Function: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular location: Mitochondrion inner membrane.
Transmembrane domains:
- 47-75, 29 AA, Helical. {ECO:0000250}.
Sequence: 79 AA
CATM prediction
The sequence of CX7A1_HUMAN returned 1 potential models
The positions at the dimer's interface are highlighted in yellow. The position at the crossing point is highlighted in orange.
| # | Sequence and interface | d | θ | Z' | ω' | Score |
|---|---|---|---|---|---|---|
| 50 60 70 + | + | + | + |
(Å) | (°) | (Å) | (°) | ||
| Model 1 | KGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFAR | 6.8 | -55.1° | 1.5 | 44.9 | -12.5 |
| Prolines* | KGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPR |
* Note: this sequence contains Pro residues. CATM substituted them with Ala during the modeling. The positions are marked.
Click on the model number to visualize its details below.
MODEL 1 DETAILS
Precited structure:
Click on the image to enlarge
Download model 1 structure: PDB, PyMOL session
List of hydrogen bonds:
| Donor | Acceptor | Distance |
|---|---|---|
| B, 59, LEU, HA | A, 58, THR, O | 3.32Å |
| B, 62, GLY, HA1 | A, 59, LEU, O | 2.76Å |
| B, 63, GLY, HA2 | A, 62, GLY, O | 3.29Å |
| B, 67, SER, HG1 | A, 66, TYR, OH | 2.05Å |
| A, 59, LEU, HA | B, 58, THR, O | 3.32Å |
| A, 62, GLY, HA1 | B, 59, LEU, O | 2.76Å |
| A, 63, GLY, HA2 | B, 62, GLY, O | 3.29Å |
| A, 67, SER, HG1 | B, 66, TYR, OH | 2.05Å |