UniProt data
UniProt name: COX8A_HUMAN (P10176)
Gene name: COX8A; Synonyms=COX8, COX8L
Organism: Homo sapiens (Human).
Function: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular location: Mitochondrion inner membrane.
Transmembrane domains:
- 37-60, 24 AA, Helical. {ECO:0000250}.
Sequence: 69 AA
CATM prediction
The sequence of COX8A_HUMAN returned 1 potential models
The positions at the dimer's interface are highlighted in yellow. The position at the crossing point is highlighted in orange.
| # | Sequence and interface | d | θ | Z' | ω' | Score |
|---|---|---|---|---|---|---|
| 40 50 60 + | + | + | |
(Å) | (°) | (Å) | (°) | ||
| Model 1 | KLGIMELAVGLTSCFVTFLLAAGWILSHLE | 7.3 | -47.0° | 2.3 | 44.8 | -20.1 |
| Prolines* | KLGIMELAVGLTSCFVTFLLPAGWILSHLE |
* Note: this sequence contains Pro residues. CATM substituted them with Ala during the modeling. The positions are marked.
Click on the model number to visualize its details below.
MODEL 1 DETAILS
Precited structure:
Click on the image to enlarge
Download model 1 structure: PDB, PyMOL session
List of hydrogen bonds:
| Donor | Acceptor | Distance |
|---|---|---|
| B, 40, LEU, HA | A, 39, GLU, O | 3.39Å |
| B, 43, GLY, HA1 | A, 40, LEU, O | 3.22Å |
| A, 40, LEU, HA | B, 39, GLU, O | 3.39Å |
| A, 43, GLY, HA1 | B, 40, LEU, O | 3.22Å |